PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr038694.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 327aa    MW: 37875 Da    PI: 7.0388
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr038694.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.29.3e-51251502128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk...k 96 
                   pGfrFhPtdeelv++yL++k+++k+++l e ik++diyk++PwdLp   +a++kewyfF+kr +ky+++ r+nr+t sg+Wkatg dk+++s+   +
  Pbr038694.1  25 LPGFRFHPTDEELVDFYLRRKIQKKPISL-ELIKSIDIYKHDPWDLP---TAGDKEWYFFCKRGRKYKNSIRPNRVTGSGFWKATGIDKPIHSHggeG 118
                  59***************************.99***************...4589***************************************86544 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  +  +glkktLv+y+g+a kg+ktdW+mhe+rl
  Pbr038694.1 119 HDCIGLKKTLVYYRGSAGKGSKTDWMMHEFRL 150
                  455***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.28E-5324188IPR003441NAC domain
PROSITE profilePS5100553.55324188IPR003441NAC domain
PfamPF023651.8E-2626150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MDSTYYSPSN KDDHQYTDDE DDVQLPGFRF HPTDEELVDF YLRRKIQKKP ISLELIKSID  60
IYKHDPWDLP TAGDKEWYFF CKRGRKYKNS IRPNRVTGSG FWKATGIDKP IHSHGGEGHD  120
CIGLKKTLVY YRGSAGKGSK TDWMMHEFRL PNPSSSNEYK NRSSNTKNMN TDPQQEAEIW  180
TLCRIFKRNV SYKKYTPDWR YLSAAKRHPT DTANSKNFAT NQQDHLDQSN TYISFGAPDI  240
CYEEKKPVVN HTNNTNNIIN GNHQLHPHAV GQLSSNMQQP ASTHPYMETF SNFSFQDLED  300
DLLNENWDEL RSVVQQLAFD PTAFLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D8e-491519410174NAC domain-containing protein 19
3swp_C8e-491519410174NAC domain-containing protein 19
3swp_B8e-491519410174NAC domain-containing protein 19
3swp_A8e-491519410174NAC domain-containing protein 19
3swm_D8e-491519410174NAC domain-containing protein 19
3swm_C8e-491519410174NAC domain-containing protein 19
3swm_B8e-491519410174NAC domain-containing protein 19
3swm_A8e-491519410174NAC domain-containing protein 19
4dul_B8e-49151947171NAC domain-containing protein 19
4dul_A8e-49151947171NAC domain-containing protein 19
1ut7_B8e-49151947171NO APICAL MERISTEM PROTEIN
1ut7_A8e-49151947171NO APICAL MERISTEM PROTEIN
1ut4_B8e-49151947171NO APICAL MERISTEM PROTEIN
1ut4_A8e-49151947171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00353DAPTransfer from AT3G12910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009345100.10.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
SwissprotQ9SK553e-80NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLM5X9400.0M5X940_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s10080.11e-107(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101334112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12910.11e-82NAC family protein